PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010104961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 444aa    MW: 48509.8 Da    PI: 7.0391
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010104961.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333892155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wtp+LHe+Fveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  XP_010104961.1 38 KPRLKWTPDLHEHFVEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 92
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.563595IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-313693IPR009057Homeodomain-like
SuperFamilySSF466891.13E-163793IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-223893IPR006447Myb domain, plants
PfamPF002493.7E-94091IPR001005SANT/Myb domain
PfamPF143793.5E-24139186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MQLSSSRMAT SIPPERHLFL QGGNGPRDSG LVLSTDAKPR LKWTPDLHEH FVEAVNQLGG  60
ADKATPKTVM KLMGIPGLTL YHLKSHLQKY RLSKNLHGQA NSGTTKIGTV GGVAADRISE  120
ASANQLNNLS IGPQANKGFH ISETLQMQIE VQRRLHEQLE VQRHLQLRME AQGKYLQAVL  180
EKAQETLGRQ NLGAVGLEAA KVQLSELVSK VSTQCLNSAF AELKEVQGGL CRQPNSSNQT  240
QGTVLIRQQQ PNNDCSMDSC LTSCEGSQKD QEIAHNTSSG IVQLRPYNNA ATTSTSNAFL  300
EPKWCNDAKD SVMFLSETRM FPVERSSNTG GLSIGIGLGG GEKGGDTSTY SQGVRFRGTG  360
SSWDVDEDFV DRNTTTASAR SAGFHDKASD HQACRVANYF ATNKVLDLNS HDHDHHDHDH  420
ENQNENHSSS TCYKQIDLNG FGWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104961.10.0Myb family transcription factor APL
TrEMBLW9S0Q10.0W9S0Q1_9R
STRINGPOPTR_0013s05670.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-121G2-like family protein